Report error Found 69 Enz. Inhib. hit(s) with all data for entry = 50014244
Affinity DataIC50: 0.600nMAssay Description:Inhibition of human GSK3A using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 0.700nMAssay Description:Inhibition of human CDK2/cyclinA using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 0.800nMAssay Description:Inhibition of human GSK3B using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of human CDK8/cyclin C incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.20nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.40nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.90nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.10nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 2.20nMAssay Description:Inhibition of human FLT3 using EAIYAAPFAKKK as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.20nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 2.20nMAssay Description:Inhibition of human CDK4/cyclin-D1 using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.60nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.70nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.70nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.80nMAssay Description:Inhibition of human CDK2/cyclinA using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.80nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.80nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3.20nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3.30nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3.30nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3.5nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3.5nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3.60nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 4.5nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 4.90nMAssay Description:Inhibition of human CDK4/cyclin-D1 using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 4.90nMAssay Description:Inhibition of human CDK1/cyclinB using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 5.10nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 5.70nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 6.30nMAssay Description:Inhibition of human PKCalpha using ERMRPRKRQGSVRRRV as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 6.5nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 6.70nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 7.10nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 8.80nMAssay Description:Inhibition of human CDK1/cyclinB using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 9nMAssay Description:Inhibition of human CDK5/p25 using histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 11nMAssay Description:Inhibition of human CDK3/cyclinE using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 15nMAssay Description:Inhibition of human CDK5/p25 using histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 17nMAssay Description:Inhibition of human TRKC using poly[Glu:Tyr] (4:1) as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 20nMAssay Description:Inhibition of human CDK8/cyclin C incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 23nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 29nMAssay Description:Inhibition of human CDK12/cyclin-K incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 31nMAssay Description:Inhibition of human CDK6/cyclin-D3 using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 35nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 36nMAssay Description:Inhibition of human CDK6/cyclin-D3 using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 42nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Human)
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 51nMAssay Description:Inhibition of human CDK3/cyclinE using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 52nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 56nMAssay Description:Inhibition of human CDK16/cyclin-Y using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 63nMAssay Description:Inhibition of human CDK14/cyclin-Y using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 78nMAssay Description:Inhibition of human CDK14/cyclin-Y using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
