Compile Data Set for Download or QSAR
Report error Found 96 Enz. Inhib. hit(s) with all data for entry = 50048966
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231948BDBM50231948(CHEMBL4066463)
Affinity DataEC50:  0.00400nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231952BDBM50231952(CHEMBL4081554)
Affinity DataEC50:  0.00600nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231902BDBM50231902(CHEMBL4096416)
Affinity DataEC50:  0.00900nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231942BDBM50231942(CHEMBL4065403)
Affinity DataEC50:  0.0110nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231896BDBM50231896(CHEMBL4084829)
Affinity DataEC50:  0.0130nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231899BDBM50231899(CHEMBL4087789)
Affinity DataEC50:  0.0200nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231947BDBM50231947(CHEMBL4062134)
Affinity DataEC50:  0.0210nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231949BDBM50231949(CHEMBL4069162)
Affinity DataEC50:  0.0230nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231943BDBM50231943(CHEMBL4093072)
Affinity DataEC50:  0.0250nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231943BDBM50231943(CHEMBL4093072)
Affinity DataEC50:  0.0250nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231900BDBM50231900(CHEMBL4060480)
Affinity DataEC50:  0.0350nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231894BDBM50231894(CHEMBL4100325)
Affinity DataEC50:  0.0410nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231888BDBM50231888(CHEMBL4081357)
Affinity DataEC50:  0.0500nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231965BDBM50231965(CHEMBL4083864)
Affinity DataEC50:  0.0500nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231887BDBM50231887(CHEMBL4091638)
Affinity DataEC50:  0.0540nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50261506BDBM50261506(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2 | CHEMBL499930)
Affinity DataEC50:  0.0600nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231895BDBM50231895(CHEMBL4073486)
Affinity DataEC50:  0.0740nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231898BDBM50231898(CHEMBL4079909)
Affinity DataEC50:  0.100nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231952BDBM50231952(CHEMBL4081554)
Affinity DataKi:  0.110nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231900BDBM50231900(CHEMBL4060480)
Affinity DataKi:  0.230nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231948BDBM50231948(CHEMBL4066463)
Affinity DataEC50:  0.25nMAssay Description:Agonist activity at GLP1R in rat INS-1 cells assessed as increase in glucose-stimulated insulin secretion after 1 hr by HTRF assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50261506BDBM50261506(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2 | CHEMBL499930)
Affinity DataKi:  0.320nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231888BDBM50231888(CHEMBL4081357)
Affinity DataKi:  0.350nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231897BDBM50231897(CHEMBL4102787)
Affinity DataEC50:  0.350nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231942BDBM50231942(CHEMBL4065403)
Affinity DataKi:  0.470nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231943BDBM50231943(CHEMBL4093072)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231949BDBM50231949(CHEMBL4069162)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231887BDBM50231887(CHEMBL4091638)
Affinity DataKi:  0.520nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231894BDBM50231894(CHEMBL4100325)
Affinity DataKi:  0.800nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231902BDBM50231902(CHEMBL4096416)
Affinity DataKi:  0.820nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231962BDBM50231962(CHEMBL4099379)
Affinity DataKi:  0.840nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231943BDBM50231943(CHEMBL4093072)
Affinity DataEC50:  0.900nMAssay Description:Agonist activity at GLP1R in rat INS-1 cells assessed as increase in glucose-stimulated insulin secretion after 1 hr by HTRF assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50261506BDBM50261506(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2 | CHEMBL499930)
Affinity DataEC50:  0.900nMAssay Description:Agonist activity at GLP1R in rat INS-1 cells assessed as increase in glucose-stimulated insulin secretion after 1 hr by HTRF assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231896BDBM50231896(CHEMBL4084829)
Affinity DataKi:  0.940nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231952BDBM50231952(CHEMBL4081554)
Affinity DataEC50:  1nMAssay Description:Agonist activity at human GLP1R expressed in CHOK1 cells assessed as induction of beta-galactosidase-tagged beta-arrestin2 recruitment incubated for ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231895BDBM50231895(CHEMBL4073486)
Affinity DataKi:  1.10nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231947BDBM50231947(CHEMBL4062134)
Affinity DataKi:  1.40nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231948BDBM50231948(CHEMBL4066463)
Affinity DataKi:  1.40nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231898BDBM50231898(CHEMBL4079909)
Affinity DataKi:  1.5nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231900BDBM50231900(CHEMBL4060480)
Affinity DataEC50:  1.5nMAssay Description:Agonist activity at human GLP1R expressed in CHOK1 cells assessed as induction of beta-galactosidase-tagged beta-arrestin2 recruitment incubated for ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231899BDBM50231899(CHEMBL4087789)
Affinity DataKi:  1.70nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231901BDBM50231901(CHEMBL4088708)
Affinity DataEC50:  1.90nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231887BDBM50231887(CHEMBL4091638)
Affinity DataEC50:  3.40nMAssay Description:Agonist activity at human GLP1R expressed in CHOK1 cells assessed as induction of beta-galactosidase-tagged beta-arrestin2 recruitment incubated for ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231949BDBM50231949(CHEMBL4069162)
Affinity DataEC50:  3.40nMAssay Description:Agonist activity at human GLP1R expressed in CHOK1 cells assessed as induction of beta-galactosidase-tagged beta-arrestin2 recruitment incubated for ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50261506BDBM50261506(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2 | CHEMBL499930)
Affinity DataEC50:  3.70nMAssay Description:Agonist activity at human GLP1R expressed in CHOK1 cells assessed as induction of beta-galactosidase-tagged beta-arrestin2 recruitment incubated for ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231888BDBM50231888(CHEMBL4081357)
Affinity DataEC50:  4.5nMAssay Description:Agonist activity at human GLP1R expressed in CHOK1 cells assessed as induction of beta-galactosidase-tagged beta-arrestin2 recruitment incubated for ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231942BDBM50231942(CHEMBL4065403)
Affinity DataEC50:  4.60nMAssay Description:Agonist activity at human GLP1R expressed in CHOK1 cells assessed as induction of beta-galactosidase-tagged beta-arrestin2 recruitment incubated for ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231962BDBM50231962(CHEMBL4099379)
Affinity DataEC50:  6.60nMAssay Description:Agonist activity at human GLP1R expressed in CHOK1 cells assessed as induction of beta-galactosidase-tagged beta-arrestin2 recruitment incubated for ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231962BDBM50231962(CHEMBL4099379)
Affinity DataEC50:  6.60nMAssay Description:Agonist activity at human GLP1R expressed in CHOK1 cells assessed as induction of beta-galactosidase-tagged beta-arrestin2 recruitment incubated for ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Human)
The University of Queensland

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231896BDBM50231896(CHEMBL4084829)
Affinity DataEC50:  6.70nMAssay Description:Agonist activity at human GLP1R expressed in CHOK1 cells assessed as induction of beta-galactosidase-tagged beta-arrestin2 recruitment incubated for ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
Displayed 1 to 50 (of 96 total ) | Next | Last >>
Jump to: