BDBM130909 US10683289, Example Staurosporine::US10927120, Compound staurosporine::US8822500, Stauro- sporine::US9920060, Staurosporine

SMILES C[C@@]12[C@@H]([C@@H](C[C@@H](O1)n3c4ccccc4c5c3c6n2c7ccccc7c6c8c5C(=O)NC8)NC)OC

InChI Key InChIKey=HKSZLNNOFSGOKW-UHFFFAOYSA-N

Data  2 KI  385 IC50

PDB links: 94 PDB IDs match this monomer.

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 387 hits for monomerid = 130909   

TargetCalcium/calmodulin-dependent protein kinase type II subunit alpha(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.0300nMAssay Description:Inhibition of human CAMK2a using KKALRRQETVDAL as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit delta(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.0370nMAssay Description:Inhibition of human CAMK2d using KKLNRTLSFAEPG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetSerine/threonine-protein kinase pim-3(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.0490nMAssay Description:Inhibition of human PIM3 using RSRHSSYPAGT as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit beta(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.0600nMAssay Description:Inhibition of human CAMK2b using KKALRRQETVDAL as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetTestis-specific serine/threonine-protein kinase 1(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.0610nMAssay Description:Inhibition of human STK22D using KKKVSRSGLYRSPSMPENLNRPR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured afte...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetTyrosine-protein kinase JAK3(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.0790nMAssay Description:Inhibition of human JAK3 using GGEEEEYFELVKKKK as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetRibosomal protein S6 kinase alpha-3(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.0860nMAssay Description:Inhibition of human RSK2 using KKLNRTLSVA as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by r...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMedPDB3D3D Structure (crystal)
TargetRibosomal protein S6 kinase alpha-6(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.102nMAssay Description:Inhibition of human RSK4 using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measur...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMedPDB3D3D Structure (crystal)
TargetRibosomal protein S6 kinase alpha-2(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.108nMAssay Description:Inhibition of human RSK3 using KKLNRTLSVA as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by r...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMedPDB3D3D Structure (crystal)
TargetBDNF/NT-3 growth factors receptor(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.112nMAssay Description:Inhibition of human TRKB using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetRibosomal protein S6 kinase alpha-1(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.118nMAssay Description:Inhibition of human RSK1 using KKLNRTLSVA as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by r...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMedPDB3D3D Structure (crystal)
TargetMitogen-activated protein kinase kinase kinase kinase 3(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.135nMAssay Description:Inhibition of human GLK/MAP4K3 using myelin basic protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured aft...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetMAP/microtubule affinity-regulating kinase 4(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.135nMAssay Description:Inhibition of human MARK4 using KKKVSRSGLYRSPSMPENLNRPR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetSerine/threonine-protein kinase MARK2(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.139nMAssay Description:Inhibition of human PAR-1Ba using KKKVSRSGLYRSPSMPENLNRPR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured aft...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.141nMAssay Description:Inhibition of human ROS using KKKSPGEYVNIEFG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.177nMAssay Description:Inhibition of human TYK2 using KKSRGDYMTMQIG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetTyrosine-protein kinase JAK2(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.178nMAssay Description:Inhibition of human JAK2 using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetProtein kinase C delta type(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.193nMAssay Description:Inhibition of human PKCd using ERMRPRKRQGSVRRRV as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 min...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.195nMAssay Description:Inhibition of human CHK1 using KKKVSRSGLYRSPSMPENLNRPR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMedPDB3D3D Structure (crystal)
TargetSerine/threonine-protein kinase N1(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.199nMAssay Description:Inhibition of human PKN1 using KKLNRTLSVA as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by r...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetNT-3 growth factor receptor(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.207nMAssay Description:Inhibition of human TRKC using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetTyrosine-protein kinase SYK(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.230nMAssay Description:Inhibition of human SYK using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 m...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMedPDB3D3D Structure (crystal)
TargetCalcium/calmodulin-dependent protein kinase type 1D(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.243nMAssay Description:Inhibition of human CAMK1d using KKALRRQETVDAL as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.248nMpH: 7.5Assay Description:Compounds to be tested were dissolved in 100% DMSO in a range of concentrations from 10-8 to 10-3 M including negative control (DMSO), then diluted w...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/2/2015
Entry Details
US Patent

TargetProtein kinase C eta type(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.251nMAssay Description:Inhibition of human PKCeta using ERMRPRKRQGSVRRRV as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 m...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetProtein kinase C epsilon type(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.286nMAssay Description:Inhibition of human PKCepsilon using ERMRPRKRQGSVRRRV as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 1...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetSerine/threonine-protein kinase SIK2(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.306nMAssay Description:Inhibition of human SIK2 using AMARAASAAALARRR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetMitogen-activated protein kinase kinase kinase kinase 5(Homo sapiens)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.308nMAssay Description:Inhibition of human KHS using myelin basic protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetProtein kinase C alpha type(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.315nMAssay Description:Inhibition of human PKCa using ERMRPRKRQGSVRRRV as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 min...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetSerine/threonine-protein kinase PAK 3(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.328nMAssay Description:Inhibition of human PAK3 using RRRLSFAEPG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by r...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetSerine/threonine-protein kinase MARK1(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.328nMAssay Description:Inhibition of human MARK1 using KKKVSRSGLYRSPSMPENLNRPR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetTyrosine-protein kinase Fer(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.350nMAssay Description:Inhibition of human FER using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 m...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit epsilon(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.365nMAssay Description:Inhibition of human IKKe using casein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by radio...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit gamma(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.366nMAssay Description:Inhibition of human CAMK2g using KKLNRTLSFAEPG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetMAP/microtubule affinity-regulating kinase 3(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.380nMAssay Description:Inhibition of human MARK3 using KKKVSRSGLYRSPSMPENLNRPR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetSerine/threonine-protein kinase SIK1(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.392nMAssay Description:Inhibition of human SIK1 using AMARAASAAALARRR as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetMitogen-activated protein kinase kinase kinase kinase 4(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.427nMAssay Description:Inhibition of human HGK using myelin basic protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetSerine/threonine-protein kinase PAK 1(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.437nMAssay Description:Inhibition of human PAK1 using RRRLSFAEPG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by r...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetMitogen-activated protein kinase kinase kinase kinase 2(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.481nMAssay Description:Inhibition of human GCK using myelin basic protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetSerine/threonine-protein kinase MRCK gamma(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.484nMAssay Description:Inhibition of human DMPK2 using KKRPQRRYSNVF as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetPhosphorylase b kinase gamma catalytic chain, liver/testis isoform(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.486nMAssay Description:Inhibition of human PHKg2 using KKLNRTLSFAEPG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetNT-3 growth factor receptor(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.525nMpH: 7.5Assay Description:Compounds to be tested were dissolved in 100% DMSO in a range of concentrations from 10-8 to 10-3 M including negative control (DMSO), then diluted w...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/2/2015
Entry Details
US Patent

TargetRibosomal protein S6 kinase beta-1(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.537nMAssay Description:Inhibition of human p70S6K using KKRNRTLTK as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMedPDB3D3D Structure (crystal)
TargetRibosomal protein S6 kinase alpha-5(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.553nMAssay Description:Inhibition of human MSK1 using GRPRTSSFAEG as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
Target3-phosphoinositide-dependent protein kinase 1(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.556nMAssay Description:Inhibition of human PDK1 using [protein fragment, 39 aa] as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMedPDB3D3D Structure (crystal)
TargetTRAF2 and NCK-interacting protein kinase(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.559nMAssay Description:Inhibition of human TNIK using RLGRDKYKTLRQIRQ as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetPlatelet-derived growth factor receptor alpha(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.577nMAssay Description:Inhibition of human PDGFRa using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 12...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetMisshapen-like kinase 1(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.581nMAssay Description:Inhibition of human MINK1 using myelin basic protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 12...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetSerine/threonine-protein kinase 38(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.584nMAssay Description:Inhibition of human STK38 using KKRNRRLSVA as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 mins by ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 0.587nMAssay Description:Inhibition of human JAK1 using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120 ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
Displayed 1 to 50 (of 387 total ) | Next | Last >>