BDBM643761 US12351590, Compound 1-13::US20240002404, Compound in Embodiment 2
SMILES CN([C@@H]1CCc2cc(nn2C1)C#N)c1ncnc2[nH]ccc12
InChI Key InChIKey=YSIFKJPIAGMGIG-UHFFFAOYSA-N
Data 8 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 8 hits for monomerid = 643761
Affinity DataIC50: 1nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity an...More data for this Ligand-Target Pair
Affinity DataIC50: 8nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM magnesium acetate and [γ-33...More data for this Ligand-Target Pair
Affinity DataIC50: 118nMAssay Description:JAK3(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and con...More data for this Ligand-Target Pair
Affinity DataIC50: 15nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and co...More data for this Ligand-Target Pair