BDBM50602430 CHEMBL5195430::US11919896, Compound 3-9
SMILES FC(F)(F)CC(=O)N1CCC2(CCC(CC2)c2cccc3nc(NC(=O)C4CC4)nn23)CC1
InChI Key InChIKey=IZUPGSOTNUPIIH-UHFFFAOYSA-N
Data 8 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 8 hits for monomerid = 50602430
Affinity DataIC50: 54nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Affinity DataIC50: 294nMAssay Description:Inhibition of recombinant human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of recombinant human JAK3 using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Affinity DataIC50: 155nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Affinity DataIC50: 155nMAssay Description:TYK2:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
Affinity DataIC50: 54nMAssay Description:JAK1:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
Affinity DataIC50: 294nMAssay Description:JAK2:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+4nMAssay Description:JAK3:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
