BDBM50033805 CHEMBL3358155

SMILES c1cc2c(cc1Cl)cc(o2)C(=O)NC[C@@]3(C(=O)NC(=O)N3)c4nccs4

InChI Key InChIKey=LBVBVIKJOWWVJX-UHFFFAOYSA-N

Data  30 IC50

PDB links: 1 PDB ID matches this monomer.

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 30 hits for monomerid = 50033805   

LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 8nMAssay Description:Inhibition of human ADAMTS-4 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/13/2016
Entry Details Article
PubMedPDB3D3D Structure (crystal)
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 8nMAssay Description:Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMedPDB3D3D Structure (crystal)
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 8nMAssay Description:Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMedPDB3D3D Structure (crystal)
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 17nMAssay Description:Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 17nMAssay Description:Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/13/2016
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 17nMAssay Description:Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 330nMAssay Description:Inhibition of human ADAMTS5 using 43-mer-VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate in presence of Lewis rat plasma measured after 3 hr...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 330nMAssay Description:Inhibition of human ADAMTS5 using 43-mer-VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate in presence of Lewis rat plasma measured after 3 hr...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 330nMAssay Description:Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay in presence of 50% rat plasmaMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/13/2016
Entry Details Article
PubMed
TargetMatrix metalloproteinase-14(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 870nMAssay Description:Inhibition of human MMP14 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/13/2016
Entry Details Article
PubMed
TargetCollagenase 3(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 930nMAssay Description:Inhibition of human MMP13 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/13/2016
Entry Details Article
PubMed
TargetCollagenase 3(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 930nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
TargetCollagenase 3(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 930nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
Target72 kDa type IV collagenase(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.80E+3nMAssay Description:Inhibition of human MMP2 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/13/2016
Entry Details Article
PubMed
Target72 kDa type IV collagenase(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.80E+3nMAssay Description:Inhibition of human MMP2 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
Target72 kDa type IV collagenase(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.80E+3nMAssay Description:Inhibition of human MMP2 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
TargetStromelysin-1(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.90E+3nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
TargetStromelysin-1(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.90E+3nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
TargetStromelysin-1(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.90E+3nMAssay Description:Inhibition of human MMP3 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/13/2016
Entry Details Article
PubMed
TargetMatrix metalloproteinase-14(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 8.70E+3nMAssay Description:Inhibition of human MMP14 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
TargetMatrix metalloproteinase-14(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 8.70E+3nMAssay Description:Inhibition of human MMP14 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
TargetMatrix metalloproteinase-9(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of human MMP9 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of human TACE using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
TargetMatrix metalloproteinase-9(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of human MMP9 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of human TACE using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/13/2016
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of human TACE using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
TargetInterstitial collagenase(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.10E+4nMAssay Description:Inhibition of human MMP1 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
TargetInterstitial collagenase(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.10E+4nMAssay Description:Inhibition of human MMP1 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
TargetMatrilysin(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of human MMP7 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed
TargetMatrilysin(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50033805BDBM50033805(CHEMBL3358155)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of human MMP7 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/27/2021
Entry Details Article
PubMed