BDBM394584 2-(6-amino-5-(1-methyl-::US10308614, Example 187
SMILES Cn1cc(cn1)-c1cc(nnc1N)-c1ccccc1O
InChI Key InChIKey=JISLSABSHWDDTJ-UHFFFAOYSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 5 hits for monomerid = 394584
Affinity DataIC50: 12.8nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvprgsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNAQ...More data for this Ligand-Target Pair
TargetIsoform Short of Probable global transcription activator SNF2L2 (Short) 377-1486](Human)
Genentech
US Patent
Genentech
US Patent
Affinity DataIC50: 10nMAssay Description:Histidine epitope tagged BRM (Isoform 2) Bromodomain1377-1486 (S1377-Q1486; Swiss Prot P51531-2; mhhhhhhgslvprgsSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLP...More data for this Ligand-Target Pair
Affinity DataIC50: 3.70nMAssay Description:Histidine-Flag-PB1-BD5 Bromodomain645-766 (S645-D766; Swiss Prot Q86U86; mhhhhhhasdykddddkgslvprgsSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAI FLRLPSRSELP...More data for this Ligand-Target Pair
Affinity DataKd: 10nMAssay Description:Binding affinity to SMARCA2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataKd: 1.28E+4nMAssay Description:Binding affinity to SMARCA4 (unknown origin)More data for this Ligand-Target Pair
