BDBM394490 2-(6-amino-5-(piperidin-1-yl)pyridazin-3-yl)phenol::US10308614, Example 90
SMILES Nc1nnc(cc1N1CCCCC1)-c1ccccc1O
InChI Key InChIKey=RJVQZTLPHCJXNB-UHFFFAOYSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 11 hits for monomerid = 394490
Affinity DataIC50: 34nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvprgsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNAQ...More data for this Ligand-Target Pair
TargetIsoform Short of Probable global transcription activator SNF2L2 (Short) 377-1486](Human)
Genentech
US Patent
Genentech
US Patent
Affinity DataIC50: 45.9nMAssay Description:Histidine epitope tagged BRM (Isoform 2) Bromodomain1377-1486 (S1377-Q1486; Swiss Prot P51531-2; mhhhhhhgslvprgsSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLP...More data for this Ligand-Target Pair
Affinity DataIC50: 13.9nMAssay Description:Histidine-Flag-PB1-BD5 Bromodomain645-766 (S645-D766; Swiss Prot Q86U86; mhhhhhhasdykddddkgslvprgsSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAI FLRLPSRSELP...More data for this Ligand-Target Pair
Affinity DataKd: 10nMAssay Description:Binding affinity to PBRM1 bromodomain 5 (unknown origin) assessed as dissociation constant by BROMOscan LeadHunter assayMore data for this Ligand-Target Pair
Affinity DataKd: 40nMAssay Description:Binding affinity to PBRM1 bromodomain 2 (unknown origin) assessed as dissociation constant by BROMOscan LeadHunter assayMore data for this Ligand-Target Pair
Affinity DataKd: 90nMAssay Description:Binding affinity to SMARCA2 (unknown origin) assessed as dissociation constant by BROMOscan LeadHunter assayMore data for this Ligand-Target Pair
Affinity DataKd: 11nMAssay Description:Binding affinity to SMARCA4 (unknown origin) assessed as dissociation constant by BROMOscan LeadHunter assayMore data for this Ligand-Target Pair
Affinity DataKd: 100nMAssay Description:Binding affinity to wild type PBRM1 bromodomain 2 (unknown origin) assessed as dissociation constant by isothermal titration calorimetric analysisMore data for this Ligand-Target Pair
Affinity DataIC50: 3.10E+3nMAssay Description:Binding affinity to PXR (unknown origin) by Lanthascreen TR-FRET assayMore data for this Ligand-Target Pair
Affinity DataEC50: >2.00E+4nMAssay Description:Binding affinity to LXR alpha (unknown origin) by Lanthascreen TR-FRET assayMore data for this Ligand-Target Pair
Affinity DataEC50: >2.00E+4nMAssay Description:Binding affinity to LXRbeta (unknown origin) by Lanthascreen TR-FRET assayMore data for this Ligand-Target Pair
