BDBM394406 2-(6-amino-5-(piperazin-::US10308614, Example 7

SMILES Nc1nnc(cc1N1CCNCC1)-c1ccccc1O

InChI Key InChIKey=SZKHGLTYXIDOFH-UHFFFAOYSA-N

Data  3 IC50  3 Kd

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 8 hits for monomerid = 394406   

TargetProtein polybromo-1(Human)
Goethe University Frankfurt

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 394406BDBM394406(US10308614, Example 7 | 2-(6-amino-5-(piperazin-)
Affinity DataKd:  26nMAssay Description:Binding affinity to polybromo-1 (5) (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/23/2022
Entry Details Article
PubMed
TargetTranscription activator BRG1(Human)
Goethe University Frankfurt

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 394406BDBM394406(US10308614, Example 7 | 2-(6-amino-5-(piperazin-)
Affinity DataKd:  73nMAssay Description:Binding affinity to SMARCA4 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/23/2022
Entry Details Article
PubMed
TargetProbable global transcription activator SNF2L2(Human)
Goethe University Frankfurt

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 394406BDBM394406(US10308614, Example 7 | 2-(6-amino-5-(piperazin-)
Affinity DataKd:  135nMAssay Description:Binding affinity to SMARCA2 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/23/2022
Entry Details Article
PubMed
TargetProbable global transcription activator SNF2L2(Human)
Goethe University Frankfurt

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 394406BDBM394406(US10308614, Example 7 | 2-(6-amino-5-(piperazin-)
Affinity DataIC50: 164nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/6/2026
Entry Details PubMed
TargetTranscription activator BRG1 [1448-1575](Human)
Genentech

US Patent
LigandChemical structure of BindingDB Monomer ID 394406BDBM394406(US10308614, Example 7 | 2-(6-amino-5-(piperazin-)
Affinity DataIC50: 214nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvprgsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNAQ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/15/2020
Entry Details
US Patent

TargetTranscription activator BRG1(Human)
Goethe University Frankfurt

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 394406BDBM394406(US10308614, Example 7 | 2-(6-amino-5-(piperazin-)
Affinity DataIC50: 255nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/6/2026
Entry Details PubMed
TargetProbable global transcription activator SNF2L2(Human)
Goethe University Frankfurt

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 394406BDBM394406(US10308614, Example 7 | 2-(6-amino-5-(piperazin-)
Affinity DataIC50: 370nMAssay Description:Inhibition of SMARCA2 BD (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/19/2024
Entry Details
PubMed
TargetTranscription activator BRG1(Human)
Goethe University Frankfurt

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 394406BDBM394406(US10308614, Example 7 | 2-(6-amino-5-(piperazin-)
Affinity DataIC50: 550nMAssay Description:Inhibition of SMARCA4 BD (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/19/2024
Entry Details
PubMed